PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_23420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family HB-other
Protein Properties Length: 264aa    MW: 30529.6 Da    PI: 4.802
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_23420genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.33.1e-09197244653
                 S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
    Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                 +++k ql++Le+++++++ p+ +++  + + ++L+ ++V  WF  +R 
  PEQU_23420 197 RLKKVQLTTLERVYARTKRPTNAMISSIVHVTDLPRKRVVKWFEDKRL 244
                 57889***************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.62189249IPR001356Homeobox domain
SuperFamilySSF466897.27E-10190252IPR009057Homeodomain-like
CDDcd000861.55E-6195243No hitNo description
SMARTSM003891.1E-4195253IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-8196246IPR009057Homeodomain-like
PfamPF000467.2E-7197244IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MHCWQKTPEY DDMEGNEKDE DAFEALFSQL EEDLKTDVTL SDDSDDEITE DDLARLEQEL  60
EEALCIEESD EVLEGVPSKS HGIDFSEDEE ESQPKLKSWQ LRRLARALKI GRRKTNIKNL  120
SAELGLERAH VLELLREPPP NLLMICASLP DEVTKKPEPV CEPVESSFDS NVSVSKNEPK  180
KEVPIHVLQK RWSMQKRLKK VQLTTLERVY ARTKRPTNAM ISSIVHVTDL PRKRVVKWFE  240
DKRLEEGVPT HREPFHRASM VMTT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010914896.12e-96PREDICTED: uncharacterized protein LOC105040183
RefseqXP_010914898.12e-96PREDICTED: uncharacterized protein LOC105040183
SwissprotQ8H0V56e-62OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
TrEMBLM0TFS71e-94M0TFS7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P08370_0013e-94(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP107003542
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.12e-53overexpressor of cationic peroxidase 3